PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000562305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 301aa    MW: 32876 Da    PI: 8.1465
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000562305genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.36.5e-4481071100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+++Cv+apyfp ++p++fanvhk+FGasnv k+l++l+ ++r+da++sl+yeAear+rdPvyG+vg+i+ lqq+l+q++a+l  
  MDP0000562305   8 PCAACKFLRRKCTPECVFAPYFPPDNPQRFANVHKVFGASNVAKILNELSASQRDDAVNSLAYEAEARLRDPVYGCVGLISLLQQRLKQVQADLFN 103
                    7********************************************************************************************988 PP

         DUF260  97 lkee 100
                    +k+e
  MDP0000562305 104 AKKE 107
                    8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8517108IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-438104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT PECVFAPYFP PDNPQRFANV HKVFGASNVA KILNELSASQ  60
RDDAVNSLAY EAEARLRDPV YGCVGLISLL QQRLKQVQAD LFNAKKELAT YIGPQAMLSI  120
LQPPTYMAQQ LQGNASSSAG PPYSMSPMMG IPTAAASGQL MIRDPQQQQQ HQQIFEAQQL  180
AAAVAXREQQ EMFRSFDQSK QAMQQQAQDH LSGFTQMAGA VGNXVLPSLA XGFDSGPYHQ  240
IQPQRPHHNH RHQLQLQAQL LLQTQQPQGQ HXAQQSQQPQ LQAKPDPGEE GGGRSVGPSC  300
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339798.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-74LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5W6J81e-130M5W6J8_PRUPE; Uncharacterized protein
STRINGVIT_00s1247g00010.t013e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-75ASYMMETRIC LEAVES 2-like 1